Description
Product Description
Protein Description: myosin binding protein H like
Gene Name: MYBPHL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068745: 88%, ENSRNOG00000037082: 88%
Entrez Gene ID: 343263
Uniprot ID: A2RUH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYBPHL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068745: 88%, ENSRNOG00000037082: 88%
Entrez Gene ID: 343263
Uniprot ID: A2RUH7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NQCGLSETAPITTDLAHIQKAATVYKTKGFAQRD |
Gene Sequence | NQCGLSETAPITTDLAHIQKAATVYKTKGFAQRD |
Gene ID - Mouse | ENSMUSG00000068745 |
Gene ID - Rat | ENSRNOG00000037082 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MYBPHL pAb (ATL-HPA077633) | |
Datasheet | Anti MYBPHL pAb (ATL-HPA077633) Datasheet (External Link) |
Vendor Page | Anti MYBPHL pAb (ATL-HPA077633) at Atlas Antibodies |
Documents & Links for Anti MYBPHL pAb (ATL-HPA077633) | |
Datasheet | Anti MYBPHL pAb (ATL-HPA077633) Datasheet (External Link) |
Vendor Page | Anti MYBPHL pAb (ATL-HPA077633) |