Anti MYB pAb (ATL-HPA071605)

Catalog No:
ATL-HPA071605-25
$395.00

Description

Product Description

Protein Description: MYB proto-oncogene, transcription factor
Gene Name: MYB
Alternative Gene Name: c-myb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019982: 93%, ENSRNOG00000055858: 93%
Entrez Gene ID: 4602
Uniprot ID: P10242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD
Gene Sequence HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD
Gene ID - Mouse ENSMUSG00000019982
Gene ID - Rat ENSRNOG00000055858
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MYB pAb (ATL-HPA071605)
Datasheet Anti MYB pAb (ATL-HPA071605) Datasheet (External Link)
Vendor Page Anti MYB pAb (ATL-HPA071605) at Atlas Antibodies

Documents & Links for Anti MYB pAb (ATL-HPA071605)
Datasheet Anti MYB pAb (ATL-HPA071605) Datasheet (External Link)
Vendor Page Anti MYB pAb (ATL-HPA071605)

Product Description

Protein Description: MYB proto-oncogene, transcription factor
Gene Name: MYB
Alternative Gene Name: c-myb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019982: 93%, ENSRNOG00000055858: 93%
Entrez Gene ID: 4602
Uniprot ID: P10242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD
Gene Sequence HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD
Gene ID - Mouse ENSMUSG00000019982
Gene ID - Rat ENSRNOG00000055858
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MYB pAb (ATL-HPA071605)
Datasheet Anti MYB pAb (ATL-HPA071605) Datasheet (External Link)
Vendor Page Anti MYB pAb (ATL-HPA071605) at Atlas Antibodies

Documents & Links for Anti MYB pAb (ATL-HPA071605)
Datasheet Anti MYB pAb (ATL-HPA071605) Datasheet (External Link)
Vendor Page Anti MYB pAb (ATL-HPA071605)