Description
Product Description
Protein Description: MYB proto-oncogene, transcription factor
Gene Name: MYB
Alternative Gene Name: c-myb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019982: 93%, ENSRNOG00000055858: 93%
Entrez Gene ID: 4602
Uniprot ID: P10242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MYB
Alternative Gene Name: c-myb
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019982: 93%, ENSRNOG00000055858: 93%
Entrez Gene ID: 4602
Uniprot ID: P10242
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD |
Gene Sequence | HSTTIADHTRPHGDSAPVSCLGEHHSTPSLPADPGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSFLNTSSNHENSD |
Gene ID - Mouse | ENSMUSG00000019982 |
Gene ID - Rat | ENSRNOG00000055858 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MYB pAb (ATL-HPA071605) | |
Datasheet | Anti MYB pAb (ATL-HPA071605) Datasheet (External Link) |
Vendor Page | Anti MYB pAb (ATL-HPA071605) at Atlas Antibodies |
Documents & Links for Anti MYB pAb (ATL-HPA071605) | |
Datasheet | Anti MYB pAb (ATL-HPA071605) Datasheet (External Link) |
Vendor Page | Anti MYB pAb (ATL-HPA071605) |