Anti MXRA5 pAb (ATL-HPA076518)

Catalog No:
ATL-HPA076518-25
$447.00
Protein Description: matrix remodeling associated 5
Gene Name: MXRA5
Alternative Gene Name: DKFZp564I1922
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036334: 28%, ENSRNOG00000013917: 28%
Entrez Gene ID: 25878
Uniprot ID: Q9NR99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence LMLSKDPRVSYQYRQDADEEALYYTGVRAQILAEPEWVMQPSIDIQLNRRQSTAKKVLLSYYTQYSQTISTKDTRQARGRSWVMIEPSGAVQRDQTVLEG
Gene ID - Mouse ENSMUSG00000036334
Gene ID - Rat ENSMUSG00000036334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MXRA5 pAb (ATL-HPA076518)
Datasheet Anti MXRA5 pAb (ATL-HPA076518) Datasheet (External Link)
Vendor Page Anti MXRA5 pAb (ATL-HPA076518) at Atlas

Documents & Links for Anti MXRA5 pAb (ATL-HPA076518)
Datasheet Anti MXRA5 pAb (ATL-HPA076518) Datasheet (External Link)
Vendor Page Anti MXRA5 pAb (ATL-HPA076518)