Protein Description: matrix remodeling associated 5
Gene Name: MXRA5
Alternative Gene Name: DKFZp564I1922
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036334: 28%, ENSRNOG00000013917: 28%
Entrez Gene ID: 25878
Uniprot ID: Q9NR99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MXRA5
Alternative Gene Name: DKFZp564I1922
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036334: 28%, ENSRNOG00000013917: 28%
Entrez Gene ID: 25878
Uniprot ID: Q9NR99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LMLSKDPRVSYQYRQDADEEALYYTGVRAQILAEPEWVMQPSIDIQLNRRQSTAKKVLLSYYTQYSQTISTKDTRQARGRSWVMIEPSGAVQRDQTVLEG |
| Documents & Links for Anti MXRA5 pAb (ATL-HPA076518) | |
| Datasheet | Anti MXRA5 pAb (ATL-HPA076518) Datasheet (External Link) |
| Vendor Page | Anti MXRA5 pAb (ATL-HPA076518) at Atlas |
| Documents & Links for Anti MXRA5 pAb (ATL-HPA076518) | |
| Datasheet | Anti MXRA5 pAb (ATL-HPA076518) Datasheet (External Link) |
| Vendor Page | Anti MXRA5 pAb (ATL-HPA076518) |