Protein Description: major vault protein
Gene Name: MVP
Alternative Gene Name: LRP, VAULT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030681: 93%, ENSRNOG00000020182: 94%
Entrez Gene ID: 9961
Uniprot ID: Q14764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MVP
Alternative Gene Name: LRP, VAULT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030681: 93%, ENSRNOG00000020182: 94%
Entrez Gene ID: 9961
Uniprot ID: Q14764
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KVSHQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPPGVEELLNKGQDPLAD |
| Documents & Links for Anti MVP pAb (ATL-HPA064740 w/enhanced validation) | |
| Datasheet | Anti MVP pAb (ATL-HPA064740 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MVP pAb (ATL-HPA064740 w/enhanced validation) at Atlas |
| Documents & Links for Anti MVP pAb (ATL-HPA064740 w/enhanced validation) | |
| Datasheet | Anti MVP pAb (ATL-HPA064740 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MVP pAb (ATL-HPA064740 w/enhanced validation) |