Anti MUC15 pAb (ATL-HPA073304 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA073304-25

• 

Product Description

Protein Description: mucin 15, cell surface associated
Gene Name: MUC15
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050808: 80%, ENSRNOG00000004703: 78%
Entrez Gene ID: 143662
Uniprot ID: Q8N387
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNPTLNDSAMPESEENARDGIPMDDIPPLRTSV
• Gene Sequence: SHRRLYDDRNEPVLRLDNAPEPYDVSFGNSSYYNPTLNDSAMPESEENARDGIPMDDIPPLRTSV
• Gene ID - Mouse: ENSMUSG00000050808
• Gene ID - Rat: ENSRNOG00000004703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.