Anti MTUS1 pAb (ATL-HPA067903)

Atlas Antibodies

Catalog No: ATL-HPA067903-25

• 

Product Description

Protein Description: microtubule associated tumor suppressor 1
Gene Name: MTUS1
Alternative Gene Name: ATBP, ATIP1, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045636: 56%, ENSRNOG00000010748: 56%
Entrez Gene ID: 57509
Uniprot ID: Q9ULD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK
• Gene Sequence: STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK
• Gene ID - Mouse: ENSMUSG00000045636
• Gene ID - Rat: ENSRNOG00000010748
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.