Protein Description: microtubule associated tumor suppressor 1
Gene Name: MTUS1
Alternative Gene Name: ATBP, ATIP1, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045636: 56%, ENSRNOG00000010748: 56%
Entrez Gene ID: 57509
Uniprot ID: Q9ULD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTUS1
Alternative Gene Name: ATBP, ATIP1, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045636: 56%, ENSRNOG00000010748: 56%
Entrez Gene ID: 57509
Uniprot ID: Q9ULD2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | STPVLEPTKVTFSVSPIEATEKCKKVEKGNRGLKNIPDSKEAPVNLCKPSLGKSTIKTNTPIGCKVRKTEIISYPRPNFKNVKAK |
Documents & Links for Anti MTUS1 pAb (ATL-HPA067903) | |
Datasheet | Anti MTUS1 pAb (ATL-HPA067903) Datasheet (External Link) |
Vendor Page | Anti MTUS1 pAb (ATL-HPA067903) at Atlas |
Documents & Links for Anti MTUS1 pAb (ATL-HPA067903) | |
Datasheet | Anti MTUS1 pAb (ATL-HPA067903) Datasheet (External Link) |
Vendor Page | Anti MTUS1 pAb (ATL-HPA067903) |