Description
Product Description
Protein Description: metastasis suppressor 1-like
Gene Name: MTSS1L
Alternative Gene Name: ABBA-1, LOC92154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033763: 82%, ENSRNOG00000017500: 84%
Entrez Gene ID: 92154
Uniprot ID: Q765P7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTSS1L
Alternative Gene Name: ABBA-1, LOC92154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033763: 82%, ENSRNOG00000017500: 84%
Entrez Gene ID: 92154
Uniprot ID: Q765P7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TPTVPDSPGYMGPTRAGSEECVFYTDETASPLAPDLAKASPKRLSLPNTAWGSPSPEAAGYPGAGAEDEQQQLA |
Gene Sequence | TPTVPDSPGYMGPTRAGSEECVFYTDETASPLAPDLAKASPKRLSLPNTAWGSPSPEAAGYPGAGAEDEQQQLA |
Gene ID - Mouse | ENSMUSG00000033763 |
Gene ID - Rat | ENSRNOG00000017500 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation) | |
Datasheet | Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation) | |
Datasheet | Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MTSS1L pAb (ATL-HPA066469 w/enhanced validation) |