![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/99269/178760/atl-hpa064003_anti-mtss1-pab-atl-hpa064003_60422__97322.1681134310.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/99269/178760/atl-hpa064003_anti-mtss1-pab-atl-hpa064003_60422__97322.1681134310.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: MTSS1, I-BAR domain containing
Gene Name: MTSS1
Alternative Gene Name: KIAA0429, MIM, MIMA, MIMB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022353: 90%, ENSRNOG00000009001: 82%
Entrez Gene ID: 9788
Uniprot ID: O43312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTSS1
Alternative Gene Name: KIAA0429, MIM, MIMA, MIMB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022353: 90%, ENSRNOG00000009001: 82%
Entrez Gene ID: 9788
Uniprot ID: O43312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GVTSMPSSMWSGQASVNPPLPGPKPSIPEEHRQAIPESEAEDQEREPPSATVSPGQIPESDPADLSP |
| Documents & Links for Anti MTSS1 pAb (ATL-HPA064003) | |
| Datasheet | Anti MTSS1 pAb (ATL-HPA064003) Datasheet (External Link) |
| Vendor Page | Anti MTSS1 pAb (ATL-HPA064003) at Atlas |
| Documents & Links for Anti MTSS1 pAb (ATL-HPA064003) | |
| Datasheet | Anti MTSS1 pAb (ATL-HPA064003) Datasheet (External Link) |
| Vendor Page | Anti MTSS1 pAb (ATL-HPA064003) |