Protein Description: mechanistic target of rapamycin (serine/threonine kinase)
Gene Name: MTOR
Alternative Gene Name: FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028991: 99%, ENSRNOG00000009615: 99%
Entrez Gene ID: 2475
Uniprot ID: P42345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTOR
Alternative Gene Name: FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028991: 99%, ENSRNOG00000009615: 99%
Entrez Gene ID: 2475
Uniprot ID: P42345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE |
Documents & Links for Anti MTOR pAb (ATL-HPA071227) | |
Datasheet | Anti MTOR pAb (ATL-HPA071227) Datasheet (External Link) |
Vendor Page | Anti MTOR pAb (ATL-HPA071227) at Atlas |
Documents & Links for Anti MTOR pAb (ATL-HPA071227) | |
Datasheet | Anti MTOR pAb (ATL-HPA071227) Datasheet (External Link) |
Vendor Page | Anti MTOR pAb (ATL-HPA071227) |