Anti MTOR pAb (ATL-HPA071227)

Atlas Antibodies

Catalog No: ATL-HPA071227-25

• 

Product Description

Protein Description: mechanistic target of rapamycin (serine/threonine kinase)
Gene Name: MTOR
Alternative Gene Name: FLJ44809, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028991: 99%, ENSRNOG00000009615: 99%
Entrez Gene ID: 2475
Uniprot ID: P42345
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE
• Gene Sequence: TESLDSTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADE
• Gene ID - Mouse: ENSMUSG00000028991
• Gene ID - Rat: ENSRNOG00000009615
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.