Description
Product Description
Protein Description: myotubularin related protein 9
Gene Name: MTMR9
Alternative Gene Name: C8orf9, DKFZp434K171, LIP-STYX, MTMR8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035078: 88%, ENSRNOG00000011560: 91%
Entrez Gene ID: 66036
Uniprot ID: Q96QG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTMR9
Alternative Gene Name: C8orf9, DKFZp434K171, LIP-STYX, MTMR8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035078: 88%, ENSRNOG00000011560: 91%
Entrez Gene ID: 66036
Uniprot ID: Q96QG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKV |
Gene Sequence | LSTLDSITLMYPFFYRPMFEVIEDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKV |
Gene ID - Mouse | ENSMUSG00000035078 |
Gene ID - Rat | ENSRNOG00000011560 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MTMR9 pAb (ATL-HPA070944) | |
Datasheet | Anti MTMR9 pAb (ATL-HPA070944) Datasheet (External Link) |
Vendor Page | Anti MTMR9 pAb (ATL-HPA070944) at Atlas Antibodies |
Documents & Links for Anti MTMR9 pAb (ATL-HPA070944) | |
Datasheet | Anti MTMR9 pAb (ATL-HPA070944) Datasheet (External Link) |
Vendor Page | Anti MTMR9 pAb (ATL-HPA070944) |