Protein Description: myotubularin related protein 11
Gene Name: MTMR11
Alternative Gene Name: CRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045934: 92%, ENSRNOG00000021176: 95%
Entrez Gene ID: 10903
Uniprot ID: A4FU01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTMR11
Alternative Gene Name: CRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045934: 92%, ENSRNOG00000021176: 95%
Entrez Gene ID: 10903
Uniprot ID: A4FU01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLPDSSVAE |
Documents & Links for Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation) | |
Datasheet | Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation) at Atlas |
Documents & Links for Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation) | |
Datasheet | Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation) |