Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation)

Catalog No:
ATL-HPA072906-25
$447.00

Description

Product Description

Protein Description: myotubularin related protein 11
Gene Name: MTMR11
Alternative Gene Name: CRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045934: 92%, ENSRNOG00000021176: 95%
Entrez Gene ID: 10903
Uniprot ID: A4FU01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLPDSSVAE
Gene Sequence EVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLPDSSVAE
Gene ID - Mouse ENSMUSG00000045934
Gene ID - Rat ENSRNOG00000021176
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation)
Datasheet Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation)

Product Description

Protein Description: myotubularin related protein 11
Gene Name: MTMR11
Alternative Gene Name: CRA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045934: 92%, ENSRNOG00000021176: 95%
Entrez Gene ID: 10903
Uniprot ID: A4FU01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLPDSSVAE
Gene Sequence EVRRAFGHFHQGRGPRLSWHHPGGSDLLRCGGFYTASDPNKEDIRAVELMLQAGHSDVVLVDTMDELPSLADVQLAHLRLRALCLPDSSVAE
Gene ID - Mouse ENSMUSG00000045934
Gene ID - Rat ENSRNOG00000021176
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation)
Datasheet Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MTMR11 pAb (ATL-HPA072906 w/enhanced validation)