Anti MTHFD1L pAb (ATL-HPA074911)

Catalog No:
ATL-HPA074911-25
$447.00

Description

Product Description

Protein Description: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Gene Name: MTHFD1L
Alternative Gene Name: DKFZP586G1517, FLJ21145, FTHFSDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040675: 76%, ENSRNOG00000019582: 76%
Entrez Gene ID: 25902
Uniprot ID: Q6UB35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS
Gene Sequence HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS
Gene ID - Mouse ENSMUSG00000040675
Gene ID - Rat ENSRNOG00000019582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MTHFD1L pAb (ATL-HPA074911)
Datasheet Anti MTHFD1L pAb (ATL-HPA074911) Datasheet (External Link)
Vendor Page Anti MTHFD1L pAb (ATL-HPA074911) at Atlas Antibodies

Documents & Links for Anti MTHFD1L pAb (ATL-HPA074911)
Datasheet Anti MTHFD1L pAb (ATL-HPA074911) Datasheet (External Link)
Vendor Page Anti MTHFD1L pAb (ATL-HPA074911)

Product Description

Protein Description: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Gene Name: MTHFD1L
Alternative Gene Name: DKFZP586G1517, FLJ21145, FTHFSDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040675: 76%, ENSRNOG00000019582: 76%
Entrez Gene ID: 25902
Uniprot ID: Q6UB35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS
Gene Sequence HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS
Gene ID - Mouse ENSMUSG00000040675
Gene ID - Rat ENSRNOG00000019582
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MTHFD1L pAb (ATL-HPA074911)
Datasheet Anti MTHFD1L pAb (ATL-HPA074911) Datasheet (External Link)
Vendor Page Anti MTHFD1L pAb (ATL-HPA074911) at Atlas Antibodies

Documents & Links for Anti MTHFD1L pAb (ATL-HPA074911)
Datasheet Anti MTHFD1L pAb (ATL-HPA074911) Datasheet (External Link)
Vendor Page Anti MTHFD1L pAb (ATL-HPA074911)