Description
Product Description
Protein Description: methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1-like
Gene Name: MTHFD1L
Alternative Gene Name: DKFZP586G1517, FLJ21145, FTHFSDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040675: 76%, ENSRNOG00000019582: 76%
Entrez Gene ID: 25902
Uniprot ID: Q6UB35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTHFD1L
Alternative Gene Name: DKFZP586G1517, FLJ21145, FTHFSDC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040675: 76%, ENSRNOG00000019582: 76%
Entrez Gene ID: 25902
Uniprot ID: Q6UB35
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS |
Gene Sequence | HGSLEAALQCLFQRKGSMTMSIQWKTRQLQSKLHEADIVVLGSPKPEEIPLTWIQPGTTVLNCSHDFLSGKVGCGS |
Gene ID - Mouse | ENSMUSG00000040675 |
Gene ID - Rat | ENSRNOG00000019582 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MTHFD1L pAb (ATL-HPA074911) | |
Datasheet | Anti MTHFD1L pAb (ATL-HPA074911) Datasheet (External Link) |
Vendor Page | Anti MTHFD1L pAb (ATL-HPA074911) at Atlas Antibodies |
Documents & Links for Anti MTHFD1L pAb (ATL-HPA074911) | |
Datasheet | Anti MTHFD1L pAb (ATL-HPA074911) Datasheet (External Link) |
Vendor Page | Anti MTHFD1L pAb (ATL-HPA074911) |