Anti MTFR1 pAb (ATL-HPA023152)

Catalog No:
ATL-HPA023152-25
$421.00
Protein Description: mitochondrial fission regulator 1
Gene Name: MTFR1
Alternative Gene Name: CHPPR, FAM54A2, KIAA0009
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027601: 75%, ENSRNOG00000021359: 81%
Entrez Gene ID: 9650
Uniprot ID: Q15390
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence KPKPVDATDPAALIAEALKKKFAYRYRSDSQDEVEKGIPKSESEATSERVLFGPHMLKPTGKMKALIENVSD
Documents & Links for Anti MTFR1 pAb (ATL-HPA023152)
Datasheet Anti MTFR1 pAb (ATL-HPA023152) Datasheet (External Link)
Vendor Page Anti MTFR1 pAb (ATL-HPA023152) at Atlas

Documents & Links for Anti MTFR1 pAb (ATL-HPA023152)
Datasheet Anti MTFR1 pAb (ATL-HPA023152) Datasheet (External Link)
Vendor Page Anti MTFR1 pAb (ATL-HPA023152)

Citations for Anti MTFR1 pAb (ATL-HPA023152) – 1 Found
Lee, Soo Jung; Kondepudi, Akhil; Young, Kelly Z; Zhang, Xiaojie; Cartee, Naw May Pearl; Chen, Jijun; Jang, Krystal Yujin; Xu, Gang; Borjigin, Jimo; Wang, Michael M. Concentration of non-myocyte proteins in arterial media of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy. Plos One. 18(2):e0281094.  PubMed