Anti MTF2 pAb (ATL-HPA069047)

Catalog No:
ATL-HPA069047-25
$447.00

Description

Product Description

Protein Description: metal response element binding transcription factor 2
Gene Name: MTF2
Alternative Gene Name: M96, PCL2, TDRD19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029267: 93%, ENSRNOG00000000075: 93%
Entrez Gene ID: 22823
Uniprot ID: Q9Y483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDE
Gene Sequence GRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDE
Gene ID - Mouse ENSMUSG00000029267
Gene ID - Rat ENSRNOG00000000075
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MTF2 pAb (ATL-HPA069047)
Datasheet Anti MTF2 pAb (ATL-HPA069047) Datasheet (External Link)
Vendor Page Anti MTF2 pAb (ATL-HPA069047) at Atlas Antibodies

Documents & Links for Anti MTF2 pAb (ATL-HPA069047)
Datasheet Anti MTF2 pAb (ATL-HPA069047) Datasheet (External Link)
Vendor Page Anti MTF2 pAb (ATL-HPA069047)

Product Description

Protein Description: metal response element binding transcription factor 2
Gene Name: MTF2
Alternative Gene Name: M96, PCL2, TDRD19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029267: 93%, ENSRNOG00000000075: 93%
Entrez Gene ID: 22823
Uniprot ID: Q9Y483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDE
Gene Sequence GRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDE
Gene ID - Mouse ENSMUSG00000029267
Gene ID - Rat ENSRNOG00000000075
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MTF2 pAb (ATL-HPA069047)
Datasheet Anti MTF2 pAb (ATL-HPA069047) Datasheet (External Link)
Vendor Page Anti MTF2 pAb (ATL-HPA069047) at Atlas Antibodies

Documents & Links for Anti MTF2 pAb (ATL-HPA069047)
Datasheet Anti MTF2 pAb (ATL-HPA069047) Datasheet (External Link)
Vendor Page Anti MTF2 pAb (ATL-HPA069047)