Protein Description: metal response element binding transcription factor 2
Gene Name: MTF2
Alternative Gene Name: M96, PCL2, TDRD19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029267: 93%, ENSRNOG00000000075: 93%
Entrez Gene ID: 22823
Uniprot ID: Q9Y483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTF2
Alternative Gene Name: M96, PCL2, TDRD19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029267: 93%, ENSRNOG00000000075: 93%
Entrez Gene ID: 22823
Uniprot ID: Q9Y483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDE |
Documents & Links for Anti MTF2 pAb (ATL-HPA069047) | |
Datasheet | Anti MTF2 pAb (ATL-HPA069047) Datasheet (External Link) |
Vendor Page | Anti MTF2 pAb (ATL-HPA069047) at Atlas |
Documents & Links for Anti MTF2 pAb (ATL-HPA069047) | |
Datasheet | Anti MTF2 pAb (ATL-HPA069047) Datasheet (External Link) |
Vendor Page | Anti MTF2 pAb (ATL-HPA069047) |