Description
Product Description
Protein Description: metastasis associated 1 family member 2
Gene Name: MTA2
Alternative Gene Name: MTA1-L1, MTA1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071646: 98%, ENSRNOG00000019913: 98%
Entrez Gene ID: 9219
Uniprot ID: O94776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MTA2
Alternative Gene Name: MTA1-L1, MTA1L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071646: 98%, ENSRNOG00000019913: 98%
Entrez Gene ID: 9219
Uniprot ID: O94776
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK |
Gene Sequence | KTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLLAKNRQTFLLQTTK |
Gene ID - Mouse | ENSMUSG00000071646 |
Gene ID - Rat | ENSRNOG00000019913 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MTA2 pAb (ATL-HPA072727) | |
Datasheet | Anti MTA2 pAb (ATL-HPA072727) Datasheet (External Link) |
Vendor Page | Anti MTA2 pAb (ATL-HPA072727) at Atlas Antibodies |
Documents & Links for Anti MTA2 pAb (ATL-HPA072727) | |
Datasheet | Anti MTA2 pAb (ATL-HPA072727) Datasheet (External Link) |
Vendor Page | Anti MTA2 pAb (ATL-HPA072727) |