Protein Description: musashi RNA binding protein 2
Gene Name: MSI2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069769: 100%, ENSRNOG00000025338: 100%
Entrez Gene ID: 124540
Uniprot ID: Q96DH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MSI2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069769: 100%, ENSRNOG00000025338: 100%
Entrez Gene ID: 124540
Uniprot ID: Q96DH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAA |
Documents & Links for Anti MSI2 pAb (ATL-HPA068990) | |
Datasheet | Anti MSI2 pAb (ATL-HPA068990) Datasheet (External Link) |
Vendor Page | Anti MSI2 pAb (ATL-HPA068990) at Atlas |
Documents & Links for Anti MSI2 pAb (ATL-HPA068990) | |
Datasheet | Anti MSI2 pAb (ATL-HPA068990) Datasheet (External Link) |
Vendor Page | Anti MSI2 pAb (ATL-HPA068990) |