Anti MSH5 pAb (ATL-HPA062688)

Atlas Antibodies

Catalog No: ATL-HPA062688-25

• 
• 

Product Description

Protein Description: mutS homolog 5
Gene Name: MSH5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000007035: 83%, ENSRNOG00000000857: 80%
Entrez Gene ID: 4439
Uniprot ID: O43196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK
• Gene Sequence: METCEDGNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLK
• Gene ID - Mouse: ENSMUSG00000007035
• Gene ID - Rat: ENSRNOG00000000857
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.