Protein Description: mutS homolog 2
Gene Name: MSH2
Alternative Gene Name: COCA1, HNPCC, HNPCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024151: 95%, ENSRNOG00000015796: 95%
Entrez Gene ID: 4436
Uniprot ID: P43246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MSH2
Alternative Gene Name: COCA1, HNPCC, HNPCC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024151: 95%, ENSRNOG00000015796: 95%
Entrez Gene ID: 4436
Uniprot ID: P43246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FDRGDFYTAHGEDALLAAREVFKTQGVIKYMGPAGAKNLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA |
| Documents & Links for Anti MSH2 pAb (ATL-HPA066845) | |
| Datasheet | Anti MSH2 pAb (ATL-HPA066845) Datasheet (External Link) |
| Vendor Page | Anti MSH2 pAb (ATL-HPA066845) at Atlas |
| Documents & Links for Anti MSH2 pAb (ATL-HPA066845) | |
| Datasheet | Anti MSH2 pAb (ATL-HPA066845) Datasheet (External Link) |
| Vendor Page | Anti MSH2 pAb (ATL-HPA066845) |