Anti MSC pAb (ATL-HPA062878)

Atlas Antibodies

Catalog No: ATL-HPA062878-25

• 
• 

Product Description

Protein Description: musculin
Gene Name: MSC
Alternative Gene Name: ABF-1, bHLHa22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025930: 74%, ENSRNOG00000007540: 81%
Entrez Gene ID: 9242
Uniprot ID: O60682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS
• Gene Sequence: TGSVSDPEEMELRGLQREYPVPASKRPPLRGVERSYASPSDNS
• Gene ID - Mouse: ENSMUSG00000025930
• Gene ID - Rat: ENSRNOG00000007540
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.