Description
Product Description
Protein Description: membrane spanning 4-domains A14
Gene Name: MS4A14
Alternative Gene Name: DKFZp434H092, FLJ32856, MS4A16, NYD-SP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099398: 40%, ENSRNOG00000025805: 37%
Entrez Gene ID: 84689
Uniprot ID: Q96JA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MS4A14
Alternative Gene Name: DKFZp434H092, FLJ32856, MS4A16, NYD-SP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099398: 40%, ENSRNOG00000025805: 37%
Entrez Gene ID: 84689
Uniprot ID: Q96JA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP |
Gene Sequence | DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP |
Gene ID - Mouse | ENSMUSG00000099398 |
Gene ID - Rat | ENSRNOG00000025805 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MS4A14 pAb (ATL-HPA058973) | |
Datasheet | Anti MS4A14 pAb (ATL-HPA058973) Datasheet (External Link) |
Vendor Page | Anti MS4A14 pAb (ATL-HPA058973) at Atlas Antibodies |
Documents & Links for Anti MS4A14 pAb (ATL-HPA058973) | |
Datasheet | Anti MS4A14 pAb (ATL-HPA058973) Datasheet (External Link) |
Vendor Page | Anti MS4A14 pAb (ATL-HPA058973) |