Anti MS4A14 pAb (ATL-HPA058973)

Catalog No:
ATL-HPA058973-25
$447.00

Description

Product Description

Protein Description: membrane spanning 4-domains A14
Gene Name: MS4A14
Alternative Gene Name: DKFZp434H092, FLJ32856, MS4A16, NYD-SP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099398: 40%, ENSRNOG00000025805: 37%
Entrez Gene ID: 84689
Uniprot ID: Q96JA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP
Gene Sequence DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP
Gene ID - Mouse ENSMUSG00000099398
Gene ID - Rat ENSRNOG00000025805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MS4A14 pAb (ATL-HPA058973)
Datasheet Anti MS4A14 pAb (ATL-HPA058973) Datasheet (External Link)
Vendor Page Anti MS4A14 pAb (ATL-HPA058973) at Atlas Antibodies

Documents & Links for Anti MS4A14 pAb (ATL-HPA058973)
Datasheet Anti MS4A14 pAb (ATL-HPA058973) Datasheet (External Link)
Vendor Page Anti MS4A14 pAb (ATL-HPA058973)

Product Description

Protein Description: membrane spanning 4-domains A14
Gene Name: MS4A14
Alternative Gene Name: DKFZp434H092, FLJ32856, MS4A16, NYD-SP21
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099398: 40%, ENSRNOG00000025805: 37%
Entrez Gene ID: 84689
Uniprot ID: Q96JA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP
Gene Sequence DQLQFVLQEEFSSDDSTTNAQSVIFGGYAFFKLTLSRSPLVSQPGNKGREFVPDEQKQSILPSPKFSEEEIEPLPP
Gene ID - Mouse ENSMUSG00000099398
Gene ID - Rat ENSRNOG00000025805
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MS4A14 pAb (ATL-HPA058973)
Datasheet Anti MS4A14 pAb (ATL-HPA058973) Datasheet (External Link)
Vendor Page Anti MS4A14 pAb (ATL-HPA058973) at Atlas Antibodies

Documents & Links for Anti MS4A14 pAb (ATL-HPA058973)
Datasheet Anti MS4A14 pAb (ATL-HPA058973) Datasheet (External Link)
Vendor Page Anti MS4A14 pAb (ATL-HPA058973)