Anti MS4A1 pAb (ATL-HPA014391 w/enhanced validation)

Catalog No:
ATL-HPA014391-25
$290.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: membrane-spanning 4-domains, subfamily A, member 1
Gene Name: MS4A1
Alternative Gene Name: B1, Bp35, CD20, MS4A2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024673: 61%, ENSRNOG00000020945: 64%
Entrez Gene ID: 931
Uniprot ID: P11836
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY

Documents & Links for Anti MS4A1 pAb (ATL-HPA014391 w/enhanced validation)
Datasheet Anti MS4A1 pAb (ATL-HPA014391 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MS4A1 pAb (ATL-HPA014391 w/enhanced validation) at Atlas

Documents & Links for Anti MS4A1 pAb (ATL-HPA014391 w/enhanced validation)
Datasheet Anti MS4A1 pAb (ATL-HPA014391 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MS4A1 pAb (ATL-HPA014391 w/enhanced validation)