Anti MRPS5 pAb (ATL-HPA055765)

Atlas Antibodies

Catalog No: ATL-HPA055765-25

• 
• 
• 

Product Description

Protein Description: mitochondrial ribosomal protein S5
Gene Name: MRPS5
Alternative Gene Name: MRP-S5, S5mt
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027374: 82%, ENSRNOG00000015192: 83%
Entrez Gene ID: 64969
Uniprot ID: P82675
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLK
• Gene Sequence: QETHQQLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRSVWSNLK
• Gene ID - Mouse: ENSMUSG00000027374
• Gene ID - Rat: ENSRNOG00000015192
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.