Anti MRPS36 pAb (ATL-HPA056795)

Atlas Antibodies

Catalog No: ATL-HPA056795-25

• 

Product Description

Protein Description: mitochondrial ribosomal protein S36
Gene Name: MRPS36
Alternative Gene Name: DC47, MRP-S36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061474: 78%, ENSRNOG00000061213: 78%
Entrez Gene ID: 92259
Uniprot ID: P82909
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS
• Gene Sequence: MMGSKMASASRVVQVVKPHTPLIRFPDRRDNPKPNVSEALRSAGLPSHS
• Gene ID - Mouse: ENSMUSG00000061474
• Gene ID - Rat: ENSRNOG00000061213
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.