Protein Description: mitochondrial ribosomal protein S27
Gene Name: MRPS27
Alternative Gene Name: KIAA0264
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041632: 75%, ENSRNOG00000017272: 79%
Entrez Gene ID: 23107
Uniprot ID: Q92552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MRPS27
Alternative Gene Name: KIAA0264
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041632: 75%, ENSRNOG00000017272: 79%
Entrez Gene ID: 23107
Uniprot ID: Q92552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FSSQLYGYALLGKVELQQGLRAVYHNMPLIWKPGYLDRALQVMEKVAASPEDIKLCREALDVLGAVLKALTSADGAS |
| Documents & Links for Anti MRPS27 pAb (ATL-HPA071751) | |
| Datasheet | Anti MRPS27 pAb (ATL-HPA071751) Datasheet (External Link) |
| Vendor Page | Anti MRPS27 pAb (ATL-HPA071751) at Atlas |
| Documents & Links for Anti MRPS27 pAb (ATL-HPA071751) | |
| Datasheet | Anti MRPS27 pAb (ATL-HPA071751) Datasheet (External Link) |
| Vendor Page | Anti MRPS27 pAb (ATL-HPA071751) |