Anti MRPS21 pAb (ATL-HPA078289)

Catalog No:
ATL-HPA078289-25
$447.00
Protein Description: mitochondrial ribosomal protein S21
Gene Name: MRPS21
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054312: 88%, ENSRNOG00000024845: 90%
Entrez Gene ID: 54460
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPC
Gene ID - Mouse ENSMUSG00000054312
Gene ID - Rat ENSMUSG00000054312
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MRPS21 pAb (ATL-HPA078289)
Datasheet Anti MRPS21 pAb (ATL-HPA078289) Datasheet (External Link)
Vendor Page Anti MRPS21 pAb (ATL-HPA078289) at Atlas

Documents & Links for Anti MRPS21 pAb (ATL-HPA078289)
Datasheet Anti MRPS21 pAb (ATL-HPA078289) Datasheet (External Link)
Vendor Page Anti MRPS21 pAb (ATL-HPA078289)