Description
Product Description
Protein Description: mitochondrial ribosomal protein S21
Gene Name: MRPS21
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054312: 88%, ENSRNOG00000024845: 90%
Entrez Gene ID: 54460
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MRPS21
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054312: 88%, ENSRNOG00000024845: 90%
Entrez Gene ID: 54460
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPC |
Gene Sequence | MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPC |
Gene ID - Mouse | ENSMUSG00000054312 |
Gene ID - Rat | ENSRNOG00000024845 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MRPS21 pAb (ATL-HPA078289) | |
Datasheet | Anti MRPS21 pAb (ATL-HPA078289) Datasheet (External Link) |
Vendor Page | Anti MRPS21 pAb (ATL-HPA078289) at Atlas Antibodies |
Documents & Links for Anti MRPS21 pAb (ATL-HPA078289) | |
Datasheet | Anti MRPS21 pAb (ATL-HPA078289) Datasheet (External Link) |
Vendor Page | Anti MRPS21 pAb (ATL-HPA078289) |