Protein Description: mitochondrial ribosomal protein S15
Gene Name: MRPS15
Alternative Gene Name: FLJ11564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028861: 77%, ENSRNOG00000008279: 76%
Entrez Gene ID: 64960
Uniprot ID: P82914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MRPS15
Alternative Gene Name: FLJ11564
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028861: 77%, ENSRNOG00000008279: 76%
Entrez Gene ID: 64960
Uniprot ID: P82914
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EQFMKKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKKMLKNLRNTNYDVFE |
Documents & Links for Anti MRPS15 pAb (ATL-HPA067137) | |
Datasheet | Anti MRPS15 pAb (ATL-HPA067137) Datasheet (External Link) |
Vendor Page | Anti MRPS15 pAb (ATL-HPA067137) at Atlas |
Documents & Links for Anti MRPS15 pAb (ATL-HPA067137) | |
Datasheet | Anti MRPS15 pAb (ATL-HPA067137) Datasheet (External Link) |
Vendor Page | Anti MRPS15 pAb (ATL-HPA067137) |