Anti MRPL3 pAb (ATL-HPA060132)

Atlas Antibodies

Catalog No: ATL-HPA060132-25

• 

Product Description

Protein Description: mitochondrial ribosomal protein L3
Gene Name: MRPL3
Alternative Gene Name: MRL3, RPML3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032563: 83%, ENSRNOG00000012650: 83%
Entrez Gene ID: 11222
Uniprot ID: P09001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGA
• Gene Sequence: PGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGA
• Gene ID - Mouse: ENSMUSG00000032563
• Gene ID - Rat: ENSRNOG00000012650
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.