Description
Product Description
Protein Description: mitochondrial ribosomal protein L3
Gene Name: MRPL3
Alternative Gene Name: MRL3, RPML3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032563: 83%, ENSRNOG00000012650: 83%
Entrez Gene ID: 11222
Uniprot ID: P09001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MRPL3
Alternative Gene Name: MRL3, RPML3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032563: 83%, ENSRNOG00000012650: 83%
Entrez Gene ID: 11222
Uniprot ID: P09001
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGA |
Gene Sequence | PGAVATGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKNCLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGA |
Gene ID - Mouse | ENSMUSG00000032563 |
Gene ID - Rat | ENSRNOG00000012650 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MRPL3 pAb (ATL-HPA060132) | |
Datasheet | Anti MRPL3 pAb (ATL-HPA060132) Datasheet (External Link) |
Vendor Page | Anti MRPL3 pAb (ATL-HPA060132) at Atlas Antibodies |
Documents & Links for Anti MRPL3 pAb (ATL-HPA060132) | |
Datasheet | Anti MRPL3 pAb (ATL-HPA060132) Datasheet (External Link) |
Vendor Page | Anti MRPL3 pAb (ATL-HPA060132) |