Protein Description: mitochondrial ribosomal protein L2
Gene Name: MRPL2
Alternative Gene Name: CGI-22, MRP-L14, RPML14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002767: 98%, ENSRNOG00000018057: 98%
Entrez Gene ID: 51069
Uniprot ID: Q5T653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MRPL2
Alternative Gene Name: CGI-22, MRP-L14, RPML14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002767: 98%, ENSRNOG00000018057: 98%
Entrez Gene ID: 51069
Uniprot ID: Q5T653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PCRSADIALVAGGSRKRWIIATENMQAGDTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAAGTCGVLL |
Documents & Links for Anti MRPL2 pAb (ATL-HPA064814) | |
Datasheet | Anti MRPL2 pAb (ATL-HPA064814) Datasheet (External Link) |
Vendor Page | Anti MRPL2 pAb (ATL-HPA064814) at Atlas |
Documents & Links for Anti MRPL2 pAb (ATL-HPA064814) | |
Datasheet | Anti MRPL2 pAb (ATL-HPA064814) Datasheet (External Link) |
Vendor Page | Anti MRPL2 pAb (ATL-HPA064814) |