Description
Product Description
Protein Description: mitochondrial ribosomal protein L13
Gene Name: MRPL13
Alternative Gene Name: L13, L13A, L13mt, RPL13, RPML13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022370: 89%, ENSRNOG00000004401: 87%
Entrez Gene ID: 28998
Uniprot ID: Q9BYD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MRPL13
Alternative Gene Name: L13, L13A, L13mt, RPL13, RPML13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022370: 89%, ENSRNOG00000004401: 87%
Entrez Gene ID: 28998
Uniprot ID: Q9BYD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | HLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPE |
Gene Sequence | HLRDPVAIVKLAIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLDEYTQEEIDAFPRLWTPPE |
Gene ID - Mouse | ENSMUSG00000022370 |
Gene ID - Rat | ENSRNOG00000004401 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MRPL13 pAb (ATL-HPA060899) | |
Datasheet | Anti MRPL13 pAb (ATL-HPA060899) Datasheet (External Link) |
Vendor Page | Anti MRPL13 pAb (ATL-HPA060899) at Atlas Antibodies |
Documents & Links for Anti MRPL13 pAb (ATL-HPA060899) | |
Datasheet | Anti MRPL13 pAb (ATL-HPA060899) Datasheet (External Link) |
Vendor Page | Anti MRPL13 pAb (ATL-HPA060899) |