Description
Product Description
Protein Description: maestro heat-like repeat family member 6
Gene Name: MROH6
Alternative Gene Name: C8orf73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098678: 56%, ENSRNOG00000032231: 53%
Entrez Gene ID: 642475
Uniprot ID: A6NGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MROH6
Alternative Gene Name: C8orf73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098678: 56%, ENSRNOG00000032231: 53%
Entrez Gene ID: 642475
Uniprot ID: A6NGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE |
Gene Sequence | LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE |
Gene ID - Mouse | ENSMUSG00000098678 |
Gene ID - Rat | ENSRNOG00000032231 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MROH6 pAb (ATL-HPA068049) | |
Datasheet | Anti MROH6 pAb (ATL-HPA068049) Datasheet (External Link) |
Vendor Page | Anti MROH6 pAb (ATL-HPA068049) at Atlas Antibodies |
Documents & Links for Anti MROH6 pAb (ATL-HPA068049) | |
Datasheet | Anti MROH6 pAb (ATL-HPA068049) Datasheet (External Link) |
Vendor Page | Anti MROH6 pAb (ATL-HPA068049) |