Anti MROH6 pAb (ATL-HPA068049)

Catalog No:
ATL-HPA068049-25
$303.00

Description

Product Description

Protein Description: maestro heat-like repeat family member 6
Gene Name: MROH6
Alternative Gene Name: C8orf73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098678: 56%, ENSRNOG00000032231: 53%
Entrez Gene ID: 642475
Uniprot ID: A6NGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE
Gene Sequence LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE
Gene ID - Mouse ENSMUSG00000098678
Gene ID - Rat ENSRNOG00000032231
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MROH6 pAb (ATL-HPA068049)
Datasheet Anti MROH6 pAb (ATL-HPA068049) Datasheet (External Link)
Vendor Page Anti MROH6 pAb (ATL-HPA068049) at Atlas Antibodies

Documents & Links for Anti MROH6 pAb (ATL-HPA068049)
Datasheet Anti MROH6 pAb (ATL-HPA068049) Datasheet (External Link)
Vendor Page Anti MROH6 pAb (ATL-HPA068049)

Product Description

Protein Description: maestro heat-like repeat family member 6
Gene Name: MROH6
Alternative Gene Name: C8orf73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098678: 56%, ENSRNOG00000032231: 53%
Entrez Gene ID: 642475
Uniprot ID: A6NGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE
Gene Sequence LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE
Gene ID - Mouse ENSMUSG00000098678
Gene ID - Rat ENSRNOG00000032231
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MROH6 pAb (ATL-HPA068049)
Datasheet Anti MROH6 pAb (ATL-HPA068049) Datasheet (External Link)
Vendor Page Anti MROH6 pAb (ATL-HPA068049) at Atlas Antibodies

Documents & Links for Anti MROH6 pAb (ATL-HPA068049)
Datasheet Anti MROH6 pAb (ATL-HPA068049) Datasheet (External Link)
Vendor Page Anti MROH6 pAb (ATL-HPA068049)