Protein Description: maestro heat-like repeat family member 6
Gene Name: MROH6
Alternative Gene Name: C8orf73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098678: 56%, ENSRNOG00000032231: 53%
Entrez Gene ID: 642475
Uniprot ID: A6NGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MROH6
Alternative Gene Name: C8orf73
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098678: 56%, ENSRNOG00000032231: 53%
Entrez Gene ID: 642475
Uniprot ID: A6NGR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPGRGATVPEAGSEPCSLNSALE |
| Documents & Links for Anti MROH6 pAb (ATL-HPA068049) | |
| Datasheet | Anti MROH6 pAb (ATL-HPA068049) Datasheet (External Link) |
| Vendor Page | Anti MROH6 pAb (ATL-HPA068049) at Atlas |
| Documents & Links for Anti MROH6 pAb (ATL-HPA068049) | |
| Datasheet | Anti MROH6 pAb (ATL-HPA068049) Datasheet (External Link) |
| Vendor Page | Anti MROH6 pAb (ATL-HPA068049) |