Anti MROH2B pAb (ATL-HPA059457)

Atlas Antibodies

Catalog No: ATL-HPA059457-25

• 

Product Description

Protein Description: maestro heat-like repeat family member 2B
Gene Name: MROH2B
Alternative Gene Name: DKFZp781F0822, FLJ40243, HEATR7B2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022155: 80%, ENSRNOG00000042182: 29%
Entrez Gene ID: 133558
Uniprot ID: Q7Z745
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKEHIQFLYERSMDALGKLLKTMMWDNVNAEDCQEMFNLLQMWLVSQKEWERERAFQITAKVLTNDIEAPENFKIGSLLGLLAPHSCDTLPTI
• Gene Sequence: DKEHIQFLYERSMDALGKLLKTMMWDNVNAEDCQEMFNLLQMWLVSQKEWERERAFQITAKVLTNDIEAPENFKIGSLLGLLAPHSCDTLPTI
• Gene ID - Mouse: ENSMUSG00000022155
• Gene ID - Rat: ENSRNOG00000042182
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.