Anti MREG pAb (ATL-HPA068583)

Atlas Antibodies

Catalog No: ATL-HPA068583-25

• 

Product Description

Protein Description: melanoregulin
Gene Name: MREG
Alternative Gene Name: DSU, FLJ10116, WDT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039395: 86%, ENSRNOG00000015774: 86%
Entrez Gene ID: 55686
Uniprot ID: Q8N565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLY
• Gene Sequence: GLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLY
• Gene ID - Mouse: ENSMUSG00000039395
• Gene ID - Rat: ENSRNOG00000015774
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.