Protein Description: melanoregulin
Gene Name: MREG
Alternative Gene Name: DSU, FLJ10116, WDT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039395: 86%, ENSRNOG00000015774: 86%
Entrez Gene ID: 55686
Uniprot ID: Q8N565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MREG
Alternative Gene Name: DSU, FLJ10116, WDT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039395: 86%, ENSRNOG00000015774: 86%
Entrez Gene ID: 55686
Uniprot ID: Q8N565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLY |
| Documents & Links for Anti MREG pAb (ATL-HPA068583) | |
| Datasheet | Anti MREG pAb (ATL-HPA068583) Datasheet (External Link) |
| Vendor Page | Anti MREG pAb (ATL-HPA068583) at Atlas |
| Documents & Links for Anti MREG pAb (ATL-HPA068583) | |
| Datasheet | Anti MREG pAb (ATL-HPA068583) Datasheet (External Link) |
| Vendor Page | Anti MREG pAb (ATL-HPA068583) |