Anti MREG pAb (ATL-HPA068583)

Catalog No:
ATL-HPA068583-25
$447.00

Description

Product Description

Protein Description: melanoregulin
Gene Name: MREG
Alternative Gene Name: DSU, FLJ10116, WDT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039395: 86%, ENSRNOG00000015774: 86%
Entrez Gene ID: 55686
Uniprot ID: Q8N565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLY
Gene Sequence GLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLY
Gene ID - Mouse ENSMUSG00000039395
Gene ID - Rat ENSRNOG00000015774
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MREG pAb (ATL-HPA068583)
Datasheet Anti MREG pAb (ATL-HPA068583) Datasheet (External Link)
Vendor Page Anti MREG pAb (ATL-HPA068583) at Atlas Antibodies

Documents & Links for Anti MREG pAb (ATL-HPA068583)
Datasheet Anti MREG pAb (ATL-HPA068583) Datasheet (External Link)
Vendor Page Anti MREG pAb (ATL-HPA068583)

Product Description

Protein Description: melanoregulin
Gene Name: MREG
Alternative Gene Name: DSU, FLJ10116, WDT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039395: 86%, ENSRNOG00000015774: 86%
Entrez Gene ID: 55686
Uniprot ID: Q8N565
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLY
Gene Sequence GLRDWLRTVCCCCGCECLEERALPEKEPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLY
Gene ID - Mouse ENSMUSG00000039395
Gene ID - Rat ENSRNOG00000015774
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MREG pAb (ATL-HPA068583)
Datasheet Anti MREG pAb (ATL-HPA068583) Datasheet (External Link)
Vendor Page Anti MREG pAb (ATL-HPA068583) at Atlas Antibodies

Documents & Links for Anti MREG pAb (ATL-HPA068583)
Datasheet Anti MREG pAb (ATL-HPA068583) Datasheet (External Link)
Vendor Page Anti MREG pAb (ATL-HPA068583)