Anti MPP5 pAb (ATL-HPA063890 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA063890-25

• 

Product Description

Protein Description: membrane palmitoylated protein 5
Gene Name: MPP5
Alternative Gene Name: FLJ12615, PALS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021112: 100%, ENSRNOG00000008788: 99%
Entrez Gene ID: 64398
Uniprot ID: Q8N3R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAI
• Gene Sequence: INSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAI
• Gene ID - Mouse: ENSMUSG00000021112
• Gene ID - Rat: ENSRNOG00000008788
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.