Protein Description: membrane palmitoylated protein 5
Gene Name: MPP5
Alternative Gene Name: FLJ12615, PALS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021112: 100%, ENSRNOG00000008788: 99%
Entrez Gene ID: 64398
Uniprot ID: Q8N3R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MPP5
Alternative Gene Name: FLJ12615, PALS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021112: 100%, ENSRNOG00000008788: 99%
Entrez Gene ID: 64398
Uniprot ID: Q8N3R9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | INSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAI |
| Documents & Links for Anti MPP5 pAb (ATL-HPA063890 w/enhanced validation) | |
| Datasheet | Anti MPP5 pAb (ATL-HPA063890 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MPP5 pAb (ATL-HPA063890 w/enhanced validation) at Atlas |
| Documents & Links for Anti MPP5 pAb (ATL-HPA063890 w/enhanced validation) | |
| Datasheet | Anti MPP5 pAb (ATL-HPA063890 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MPP5 pAb (ATL-HPA063890 w/enhanced validation) |