Protein Description: membrane palmitoylated protein 2
Gene Name: MPP2
Alternative Gene Name: DKFZp761D0712, DLG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017314: 100%, ENSRNOG00000059683: 100%
Entrez Gene ID: 4355
Uniprot ID: Q14168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MPP2
Alternative Gene Name: DKFZp761D0712, DLG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017314: 100%, ENSRNOG00000059683: 100%
Entrez Gene ID: 4355
Uniprot ID: Q14168
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVT |
| Documents & Links for Anti MPP2 pAb (ATL-HPA073483 w/enhanced validation) | |
| Datasheet | Anti MPP2 pAb (ATL-HPA073483 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MPP2 pAb (ATL-HPA073483 w/enhanced validation) at Atlas |
| Documents & Links for Anti MPP2 pAb (ATL-HPA073483 w/enhanced validation) | |
| Datasheet | Anti MPP2 pAb (ATL-HPA073483 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MPP2 pAb (ATL-HPA073483 w/enhanced validation) |