Anti MPO pAb (ATL-HPA061464 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA061464-25

• 
• 
• 

Product Description

Protein Description: myeloperoxidase
Gene Name: MPO
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009350: 76%, ENSRNOG00000008310: 74%
Entrez Gene ID: 4353
Uniprot ID: P05164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR
• Gene Sequence: GAAPAVLGEVDTSLVLSSMEEAKQLVDKAYKERRESIKQRLR
• Gene ID - Mouse: ENSMUSG00000009350
• Gene ID - Rat: ENSRNOG00000008310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti MPO pAb (ATL-HPA061464 w/enhanced validation) – 2 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Omeljaniuk, Wioleta Justyna; Jabłońska, Ewa; Garley, Marzena; Pryczynicz, Anna; Ratajczak-Wrona, Wioletta; Socha, Katarzyna; Borawska, Maria Halina; Charkiewicz, Angelika Edyta. Biomarkers of neutrophil extracellular traps (NETs) and nitric oxide-(NO)-dependent oxidative stress in women who miscarried. Scientific Reports. 2020;10(1):13088.