Description
Product Description
Protein Description: M-phase specific PLK1 interacting protein
Gene Name: MPLKIP
Alternative Gene Name: C7orf11, ORF20, TTDN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012429: 94%, ENSRNOG00000013806: 94%
Entrez Gene ID: 136647
Uniprot ID: Q8TAP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MPLKIP
Alternative Gene Name: C7orf11, ORF20, TTDN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012429: 94%, ENSRNOG00000013806: 94%
Entrez Gene ID: 136647
Uniprot ID: Q8TAP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVR |
Gene Sequence | FGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVR |
Gene ID - Mouse | ENSMUSG00000012429 |
Gene ID - Rat | ENSRNOG00000013806 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MPLKIP pAb (ATL-HPA065463) | |
Datasheet | Anti MPLKIP pAb (ATL-HPA065463) Datasheet (External Link) |
Vendor Page | Anti MPLKIP pAb (ATL-HPA065463) at Atlas Antibodies |
Documents & Links for Anti MPLKIP pAb (ATL-HPA065463) | |
Datasheet | Anti MPLKIP pAb (ATL-HPA065463) Datasheet (External Link) |
Vendor Page | Anti MPLKIP pAb (ATL-HPA065463) |