Anti MPLKIP pAb (ATL-HPA065463)

Catalog No:
ATL-HPA065463-25
$447.00

Description

Product Description

Protein Description: M-phase specific PLK1 interacting protein
Gene Name: MPLKIP
Alternative Gene Name: C7orf11, ORF20, TTDN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012429: 94%, ENSRNOG00000013806: 94%
Entrez Gene ID: 136647
Uniprot ID: Q8TAP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVR
Gene Sequence FGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVR
Gene ID - Mouse ENSMUSG00000012429
Gene ID - Rat ENSRNOG00000013806
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MPLKIP pAb (ATL-HPA065463)
Datasheet Anti MPLKIP pAb (ATL-HPA065463) Datasheet (External Link)
Vendor Page Anti MPLKIP pAb (ATL-HPA065463) at Atlas Antibodies

Documents & Links for Anti MPLKIP pAb (ATL-HPA065463)
Datasheet Anti MPLKIP pAb (ATL-HPA065463) Datasheet (External Link)
Vendor Page Anti MPLKIP pAb (ATL-HPA065463)

Product Description

Protein Description: M-phase specific PLK1 interacting protein
Gene Name: MPLKIP
Alternative Gene Name: C7orf11, ORF20, TTDN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012429: 94%, ENSRNOG00000013806: 94%
Entrez Gene ID: 136647
Uniprot ID: Q8TAP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVR
Gene Sequence FGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVR
Gene ID - Mouse ENSMUSG00000012429
Gene ID - Rat ENSRNOG00000013806
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MPLKIP pAb (ATL-HPA065463)
Datasheet Anti MPLKIP pAb (ATL-HPA065463) Datasheet (External Link)
Vendor Page Anti MPLKIP pAb (ATL-HPA065463) at Atlas Antibodies

Documents & Links for Anti MPLKIP pAb (ATL-HPA065463)
Datasheet Anti MPLKIP pAb (ATL-HPA065463) Datasheet (External Link)
Vendor Page Anti MPLKIP pAb (ATL-HPA065463)