Anti MPLKIP pAb (ATL-HPA058457)

Atlas Antibodies

Catalog No: ATL-HPA058457-25

• 
• 

Product Description

Protein Description: M-phase specific PLK1 interacting protein
Gene Name: MPLKIP
Alternative Gene Name: C7orf11, ORF20, TTDN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012429: 96%, ENSRNOG00000013806: 96%
Entrez Gene ID: 136647
Uniprot ID: Q8TAP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
• Gene Sequence: EKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
• Gene ID - Mouse: ENSMUSG00000012429
• Gene ID - Rat: ENSRNOG00000013806
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.