Protein Description: megakaryocyte and platelet inhibitory receptor G6b
Gene Name: MPIG6B
Alternative Gene Name: C6orf25, G6b, G6b-B, NG31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073414: 82%, ENSRNOG00000026936: 85%
Entrez Gene ID: 80739
Uniprot ID: O95866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MPIG6B
Alternative Gene Name: C6orf25, G6b, G6b-B, NG31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073414: 82%, ENSRNOG00000026936: 85%
Entrez Gene ID: 80739
Uniprot ID: O95866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGR |
| Documents & Links for Anti MPIG6B pAb (ATL-HPA073017) | |
| Datasheet | Anti MPIG6B pAb (ATL-HPA073017) Datasheet (External Link) |
| Vendor Page | Anti MPIG6B pAb (ATL-HPA073017) at Atlas |
| Documents & Links for Anti MPIG6B pAb (ATL-HPA073017) | |
| Datasheet | Anti MPIG6B pAb (ATL-HPA073017) Datasheet (External Link) |
| Vendor Page | Anti MPIG6B pAb (ATL-HPA073017) |