Anti MORN1 pAb (ATL-HPA070703)

Atlas Antibodies

Catalog No: ATL-HPA070703-25

• 

Product Description

Protein Description: MORN repeat containing 1
Gene Name: MORN1
Alternative Gene Name: FLJ13941
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029049: 77%, ENSRNOG00000014642: 72%
Entrez Gene ID: 79906
Uniprot ID: Q5T089
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPF
• Gene Sequence: SGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPF
• Gene ID - Mouse: ENSMUSG00000029049
• Gene ID - Rat: ENSRNOG00000014642
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.