Anti MORF4L1 pAb (ATL-HPA062010)

Atlas Antibodies

Catalog No: ATL-HPA062010-25

• 
• 

Product Description

Protein Description: mortality factor 4 like 1
Gene Name: MORF4L1
Alternative Gene Name: Eaf3, HsT17725, MEAF3, MORFRG15, MRG15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062270: 100%, ENSRNOG00000058412: 100%
Entrez Gene ID: 10933
Uniprot ID: Q9UBU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQK
• Gene Sequence: QKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQK
• Gene ID - Mouse: ENSMUSG00000062270
• Gene ID - Rat: ENSRNOG00000058412
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.