Description
Product Description
Protein Description: MON1 secretory trafficking family member A
Gene Name: MON1A
Alternative Gene Name: MGC13272, SAND1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032583: 100%, ENSRNOG00000018502: 100%
Entrez Gene ID: 84315
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MON1A
Alternative Gene Name: MGC13272, SAND1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032583: 100%, ENSRNOG00000018502: 100%
Entrez Gene ID: 84315
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQN |
Gene Sequence | VALVSFLEADKNAIRSIHADGYKVVFVRRSPLVLVAVARTRQSAQELAQELLYIYYQILSLLTGAQLSHIFQQKQN |
Gene ID - Mouse | ENSMUSG00000032583 |
Gene ID - Rat | ENSRNOG00000018502 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MON1A pAb (ATL-HPA058032) | |
Datasheet | Anti MON1A pAb (ATL-HPA058032) Datasheet (External Link) |
Vendor Page | Anti MON1A pAb (ATL-HPA058032) at Atlas Antibodies |
Documents & Links for Anti MON1A pAb (ATL-HPA058032) | |
Datasheet | Anti MON1A pAb (ATL-HPA058032) Datasheet (External Link) |
Vendor Page | Anti MON1A pAb (ATL-HPA058032) |