Anti MOCS1 pAb (ATL-HPA075505)

Atlas Antibodies

Catalog No: ATL-HPA075505-25

• 

Product Description

Protein Description: molybdenum cofactor synthesis 1
Gene Name: MOCS1
Alternative Gene Name: MOCOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064120: 96%, ENSRNOG00000011784: 95%
Entrez Gene ID: 4337
Uniprot ID: Q9NZB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFSISQMKN
• Gene Sequence: TSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFSISQMKN
• Gene ID - Mouse: ENSMUSG00000064120
• Gene ID - Rat: ENSRNOG00000011784
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.