Anti MOCS1 pAb (ATL-HPA075505)

Catalog No:
ATL-HPA075505-25
$447.00
Protein Description: molybdenum cofactor synthesis 1
Gene Name: MOCS1
Alternative Gene Name: MOCOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064120: 96%, ENSRNOG00000011784: 95%
Entrez Gene ID: 4337
Uniprot ID: Q9NZB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence TSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFSISQMKN
Gene ID - Mouse ENSMUSG00000064120
Gene ID - Rat ENSMUSG00000064120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti MOCS1 pAb (ATL-HPA075505)
Datasheet Anti MOCS1 pAb (ATL-HPA075505) Datasheet (External Link)
Vendor Page Anti MOCS1 pAb (ATL-HPA075505) at Atlas

Documents & Links for Anti MOCS1 pAb (ATL-HPA075505)
Datasheet Anti MOCS1 pAb (ATL-HPA075505) Datasheet (External Link)
Vendor Page Anti MOCS1 pAb (ATL-HPA075505)