Protein Description: molybdenum cofactor synthesis 1
Gene Name: MOCS1
Alternative Gene Name: MOCOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064120: 96%, ENSRNOG00000011784: 95%
Entrez Gene ID: 4337
Uniprot ID: Q9NZB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MOCS1
Alternative Gene Name: MOCOD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064120: 96%, ENSRNOG00000011784: 95%
Entrez Gene ID: 4337
Uniprot ID: Q9NZB8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKKRQHAGMFSISQMKN |
Gene ID - Mouse | ENSMUSG00000064120 |
Gene ID - Rat | ENSMUSG00000064120 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MOCS1 pAb (ATL-HPA075505) | |
Datasheet | Anti MOCS1 pAb (ATL-HPA075505) Datasheet (External Link) |
Vendor Page | Anti MOCS1 pAb (ATL-HPA075505) at Atlas |
Documents & Links for Anti MOCS1 pAb (ATL-HPA075505) | |
Datasheet | Anti MOCS1 pAb (ATL-HPA075505) Datasheet (External Link) |
Vendor Page | Anti MOCS1 pAb (ATL-HPA075505) |