Protein Description: MOB kinase activator 1A
Gene Name: MOB1A
Alternative Gene Name: C2orf6, FLJ10788, FLJ11595, Mats1, MOB1, Mob4B, MOBK1B, MOBKL1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006262: 100%, ENSRNOG00000059474: 100%
Entrez Gene ID: 55233
Uniprot ID: Q9H8S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MOB1A
Alternative Gene Name: C2orf6, FLJ10788, FLJ11595, Mats1, MOB1, Mob4B, MOBK1B, MOBKL1B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006262: 100%, ENSRNOG00000059474: 100%
Entrez Gene ID: 55233
Uniprot ID: Q9H8S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL |
Documents & Links for Anti MOB1A pAb (ATL-HPA071690) | |
Datasheet | Anti MOB1A pAb (ATL-HPA071690) Datasheet (External Link) |
Vendor Page | Anti MOB1A pAb (ATL-HPA071690) at Atlas |
Documents & Links for Anti MOB1A pAb (ATL-HPA071690) | |
Datasheet | Anti MOB1A pAb (ATL-HPA071690) Datasheet (External Link) |
Vendor Page | Anti MOB1A pAb (ATL-HPA071690) |