Description
Product Description
Protein Description: modulator of apoptosis 1
Gene Name: MOAP1
Alternative Gene Name: MAP-1, PNMA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096458: 68%, ENSRNOG00000033970: 68%
Entrez Gene ID: 64112
Uniprot ID: Q96BY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MOAP1
Alternative Gene Name: MAP-1, PNMA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096458: 68%, ENSRNOG00000033970: 68%
Entrez Gene ID: 64112
Uniprot ID: Q96BY2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF |
Gene Sequence | GEGMTVGELSRALGHENGSLDPEQGMIPEMWAPMLAQALEALQPALQCLKYKKLRVFSGRESPEPGEEEFGRWMF |
Gene ID - Mouse | ENSMUSG00000096458 |
Gene ID - Rat | ENSRNOG00000033970 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MOAP1 pAb (ATL-HPA076948) | |
Datasheet | Anti MOAP1 pAb (ATL-HPA076948) Datasheet (External Link) |
Vendor Page | Anti MOAP1 pAb (ATL-HPA076948) at Atlas Antibodies |
Documents & Links for Anti MOAP1 pAb (ATL-HPA076948) | |
Datasheet | Anti MOAP1 pAb (ATL-HPA076948) Datasheet (External Link) |
Vendor Page | Anti MOAP1 pAb (ATL-HPA076948) |