Anti MMS22L pAb (ATL-HPA067042)

Catalog No:
ATL-HPA067042-25
$303.00

Description

Product Description

Protein Description: MMS22-like, DNA repair protein
Gene Name: MMS22L
Alternative Gene Name: C6orf167, dJ39B17.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045751: 81%, ENSRNOG00000006996: 82%
Entrez Gene ID: 253714
Uniprot ID: Q6ZRQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISIIQLFGWDDIICPQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRC
Gene Sequence MSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISIIQLFGWDDIICPQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRC
Gene ID - Mouse ENSMUSG00000045751
Gene ID - Rat ENSRNOG00000006996
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MMS22L pAb (ATL-HPA067042)
Datasheet Anti MMS22L pAb (ATL-HPA067042) Datasheet (External Link)
Vendor Page Anti MMS22L pAb (ATL-HPA067042) at Atlas Antibodies

Documents & Links for Anti MMS22L pAb (ATL-HPA067042)
Datasheet Anti MMS22L pAb (ATL-HPA067042) Datasheet (External Link)
Vendor Page Anti MMS22L pAb (ATL-HPA067042)

Product Description

Protein Description: MMS22-like, DNA repair protein
Gene Name: MMS22L
Alternative Gene Name: C6orf167, dJ39B17.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045751: 81%, ENSRNOG00000006996: 82%
Entrez Gene ID: 253714
Uniprot ID: Q6ZRQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISIIQLFGWDDIICPQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRC
Gene Sequence MSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISIIQLFGWDDIICPQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRC
Gene ID - Mouse ENSMUSG00000045751
Gene ID - Rat ENSRNOG00000006996
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MMS22L pAb (ATL-HPA067042)
Datasheet Anti MMS22L pAb (ATL-HPA067042) Datasheet (External Link)
Vendor Page Anti MMS22L pAb (ATL-HPA067042) at Atlas Antibodies

Documents & Links for Anti MMS22L pAb (ATL-HPA067042)
Datasheet Anti MMS22L pAb (ATL-HPA067042) Datasheet (External Link)
Vendor Page Anti MMS22L pAb (ATL-HPA067042)