Protein Description: MMS22-like, DNA repair protein
Gene Name: MMS22L
Alternative Gene Name: C6orf167, dJ39B17.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045751: 81%, ENSRNOG00000006996: 82%
Entrez Gene ID: 253714
Uniprot ID: Q6ZRQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MMS22L
Alternative Gene Name: C6orf167, dJ39B17.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045751: 81%, ENSRNOG00000006996: 82%
Entrez Gene ID: 253714
Uniprot ID: Q6ZRQ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISIIQLFGWDDIICPQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRC |
| Documents & Links for Anti MMS22L pAb (ATL-HPA067042) | |
| Datasheet | Anti MMS22L pAb (ATL-HPA067042) Datasheet (External Link) |
| Vendor Page | Anti MMS22L pAb (ATL-HPA067042) at Atlas |
| Documents & Links for Anti MMS22L pAb (ATL-HPA067042) | |
| Datasheet | Anti MMS22L pAb (ATL-HPA067042) Datasheet (External Link) |
| Vendor Page | Anti MMS22L pAb (ATL-HPA067042) |