Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation)

Catalog No:
ATL-HPA063909-25
$328.00

Description

Product Description

Protein Description: matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Gene Name: MMP9
Alternative Gene Name: CLG4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017737: 58%, ENSRNOG00000017539: 57%
Entrez Gene ID: 4318
Uniprot ID: P14780
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE
Gene Sequence WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE
Gene ID - Mouse ENSMUSG00000017737
Gene ID - Rat ENSRNOG00000017539
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation)
Datasheet Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation)
Datasheet Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation)

Citations

Citations for Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed

Product Description

Protein Description: matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)
Gene Name: MMP9
Alternative Gene Name: CLG4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017737: 58%, ENSRNOG00000017539: 57%
Entrez Gene ID: 4318
Uniprot ID: P14780
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE
Gene Sequence WRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPE
Gene ID - Mouse ENSMUSG00000017737
Gene ID - Rat ENSRNOG00000017539
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation)
Datasheet Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation)
Datasheet Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation)

Citations

Citations for Anti MMP9 pAb (ATL-HPA063909 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed