Protein Description: matrix metallopeptidase 27
Gene Name: MMP27
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070323: 86%, ENSRNOG00000040208: 83%
Entrez Gene ID: 64066
Uniprot ID: Q9H306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MMP27
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070323: 86%, ENSRNOG00000040208: 83%
Entrez Gene ID: 64066
Uniprot ID: Q9H306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDYPKSIHTLGFPGRVKKIDAAVCDKTTR |
| Documents & Links for Anti MMP27 pAb (ATL-HPA069097) | |
| Datasheet | Anti MMP27 pAb (ATL-HPA069097) Datasheet (External Link) |
| Vendor Page | Anti MMP27 pAb (ATL-HPA069097) at Atlas |
| Documents & Links for Anti MMP27 pAb (ATL-HPA069097) | |
| Datasheet | Anti MMP27 pAb (ATL-HPA069097) Datasheet (External Link) |
| Vendor Page | Anti MMP27 pAb (ATL-HPA069097) |