Protein Description: matrix metallopeptidase 11 (stromelysin 3)
Gene Name: MMP11
Alternative Gene Name: STMY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000901: 78%, ENSRNOG00000054959: 78%
Entrez Gene ID: 4320
Uniprot ID: P24347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MMP11
Alternative Gene Name: STMY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000901: 78%, ENSRNOG00000054959: 78%
Entrez Gene ID: 4320
Uniprot ID: P24347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA |
| Documents & Links for Anti MMP11 pAb (ATL-HPA068864) | |
| Datasheet | Anti MMP11 pAb (ATL-HPA068864) Datasheet (External Link) |
| Vendor Page | Anti MMP11 pAb (ATL-HPA068864) at Atlas |
| Documents & Links for Anti MMP11 pAb (ATL-HPA068864) | |
| Datasheet | Anti MMP11 pAb (ATL-HPA068864) Datasheet (External Link) |
| Vendor Page | Anti MMP11 pAb (ATL-HPA068864) |