Description
Product Description
Protein Description: matrix metallopeptidase 11 (stromelysin 3)
Gene Name: MMP11
Alternative Gene Name: STMY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000901: 78%, ENSRNOG00000054959: 78%
Entrez Gene ID: 4320
Uniprot ID: P24347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MMP11
Alternative Gene Name: STMY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000901: 78%, ENSRNOG00000054959: 78%
Entrez Gene ID: 4320
Uniprot ID: P24347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA |
Gene Sequence | EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA |
Gene ID - Mouse | ENSMUSG00000000901 |
Gene ID - Rat | ENSRNOG00000054959 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MMP11 pAb (ATL-HPA068864) | |
Datasheet | Anti MMP11 pAb (ATL-HPA068864) Datasheet (External Link) |
Vendor Page | Anti MMP11 pAb (ATL-HPA068864) at Atlas Antibodies |
Documents & Links for Anti MMP11 pAb (ATL-HPA068864) | |
Datasheet | Anti MMP11 pAb (ATL-HPA068864) Datasheet (External Link) |
Vendor Page | Anti MMP11 pAb (ATL-HPA068864) |