Anti MMP11 pAb (ATL-HPA068864)

Catalog No:
ATL-HPA068864-25
$395.00

Description

Product Description

Protein Description: matrix metallopeptidase 11 (stromelysin 3)
Gene Name: MMP11
Alternative Gene Name: STMY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000901: 78%, ENSRNOG00000054959: 78%
Entrez Gene ID: 4320
Uniprot ID: P24347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
Gene Sequence EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
Gene ID - Mouse ENSMUSG00000000901
Gene ID - Rat ENSRNOG00000054959
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MMP11 pAb (ATL-HPA068864)
Datasheet Anti MMP11 pAb (ATL-HPA068864) Datasheet (External Link)
Vendor Page Anti MMP11 pAb (ATL-HPA068864) at Atlas Antibodies

Documents & Links for Anti MMP11 pAb (ATL-HPA068864)
Datasheet Anti MMP11 pAb (ATL-HPA068864) Datasheet (External Link)
Vendor Page Anti MMP11 pAb (ATL-HPA068864)

Product Description

Protein Description: matrix metallopeptidase 11 (stromelysin 3)
Gene Name: MMP11
Alternative Gene Name: STMY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000901: 78%, ENSRNOG00000054959: 78%
Entrez Gene ID: 4320
Uniprot ID: P24347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
Gene Sequence EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA
Gene ID - Mouse ENSMUSG00000000901
Gene ID - Rat ENSRNOG00000054959
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti MMP11 pAb (ATL-HPA068864)
Datasheet Anti MMP11 pAb (ATL-HPA068864) Datasheet (External Link)
Vendor Page Anti MMP11 pAb (ATL-HPA068864) at Atlas Antibodies

Documents & Links for Anti MMP11 pAb (ATL-HPA068864)
Datasheet Anti MMP11 pAb (ATL-HPA068864) Datasheet (External Link)
Vendor Page Anti MMP11 pAb (ATL-HPA068864)