Protein Description: motilin
Gene Name: MLN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040761: 34%, ENSRNOG00000058439: 30%
Entrez Gene ID: 4295
Uniprot ID: P12872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MLN
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040761: 34%, ENSRNOG00000058439: 30%
Entrez Gene ID: 4295
Uniprot ID: P12872
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AFVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEEN |
| Documents & Links for Anti MLN pAb (ATL-HPA069392 w/enhanced validation) | |
| Datasheet | Anti MLN pAb (ATL-HPA069392 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLN pAb (ATL-HPA069392 w/enhanced validation) at Atlas |
| Documents & Links for Anti MLN pAb (ATL-HPA069392 w/enhanced validation) | |
| Datasheet | Anti MLN pAb (ATL-HPA069392 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MLN pAb (ATL-HPA069392 w/enhanced validation) |