Anti MLKL pAb (ATL-HPA078638)

Atlas Antibodies

Catalog No: ATL-HPA078638-25

• 

Product Description

Protein Description: mixed lineage kinase domain like pseudokinase
Gene Name: MLKL
Alternative Gene Name: FLJ34389
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012519: 46%, ENSRNOG00000042353: 48%
Entrez Gene ID: 197259
Uniprot ID: Q8NB16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRL
• Gene Sequence: LQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRL
• Gene ID - Mouse: ENSMUSG00000012519
• Gene ID - Rat: ENSRNOG00000042353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.