Description
Product Description
Protein Description: mixed lineage kinase domain like pseudokinase
Gene Name: MLKL
Alternative Gene Name: FLJ34389
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012519: 46%, ENSRNOG00000042353: 48%
Entrez Gene ID: 197259
Uniprot ID: Q8NB16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: MLKL
Alternative Gene Name: FLJ34389
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000012519: 46%, ENSRNOG00000042353: 48%
Entrez Gene ID: 197259
Uniprot ID: Q8NB16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRL |
Gene Sequence | LQDQGKRSVPSEKLTTAMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRL |
Gene ID - Mouse | ENSMUSG00000012519 |
Gene ID - Rat | ENSRNOG00000042353 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti MLKL pAb (ATL-HPA078638) | |
Datasheet | Anti MLKL pAb (ATL-HPA078638) Datasheet (External Link) |
Vendor Page | Anti MLKL pAb (ATL-HPA078638) at Atlas Antibodies |
Documents & Links for Anti MLKL pAb (ATL-HPA078638) | |
Datasheet | Anti MLKL pAb (ATL-HPA078638) Datasheet (External Link) |
Vendor Page | Anti MLKL pAb (ATL-HPA078638) |